PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004493815.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 488aa    MW: 53441.6 Da    PI: 5.5409
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004493815.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.51.7e-34262316155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr+rWtpeLHe+Fveav+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  XP_004493815.1 262 KPRMRWTPELHEAFVEAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 316
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.061259319IPR017930Myb domain
SuperFamilySSF466893.94E-18260316IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-32261318IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-25262316IPR006447Myb domain, plants
PfamPF002494.6E-10264315IPR001005SANT/Myb domain
PfamPF143799.3E-26347394IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MDARPAFSIE RSSTKQMNNI GMSGAFPSSL SVLPTHLEET YPRLSDSQSS FVENDLKTIT  60
FNHPSHISSS GAVGHMFSSS PGYSTDLHHS SLSPHEKNSR NAHFISQSLS NVASMPLSYS  120
SNNGPVPSTT SIHYSNGNST SWHADSLPSF LDFATNTSID NNQVDSSAGN IMATEEFSKR  180
NDWQEWADQL ISDDDTLTSN WNDLLADNIH DLEPKAVDLV SKSSSQFPAG HQSQGHQQLM  240
ALSGENHVGA APSSSANSAP AKPRMRWTPE LHEAFVEAVN QLGGSERATP KGVLKLMKVE  300
GLTIYHVKSH LQKYRTARYR PEPSEGAAEK NLSPIDDISS LDLKTGIEIT EALRLQMEVQ  360
KRLHEQLEIQ RNLQLRIEEQ GRYLQKMFEK QCKSGVEPFK ASPSAIENPS GMSSDIVKDS  420
PTKNELEASK TDHSGSGSDQ ANGGTTVEES SLKAGGKQDT SKSQAFEDLK QNDNEDSTQA  480
PKRPRTDE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1354860.0BT135486.1 Medicago truncatula clone JCVI-FLMt-21A2 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004493814.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_004493815.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLG7KXD80.0G7KXD8_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA19G35080.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-103phosphate starvation response 1